Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0270 (MJ0270)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0270 (MJ0270) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0270

UniProt

Q57718

Expression Region

1-78

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNKREKMRPKSSTILILLMSVLILLLSIDILANHIIIKVDGYYYDGLGQKLAMKDVIPI NASFNKIKSQLEKSMKFH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8A Mouse Monoclonal Antibody [Clone ID: C8/468 + C8/144B]
AM33320PU-S 100 µg

CD8A Mouse Monoclonal Antibody [Clone ID: C8/468 + C8/144B]

Sign In for Pricing
View Details
ETS1 (Marker of Tumor Metastasis) (ETS1/1801), CF405S conjugate, 0.1mg/mL
BNC041801-100 1x 100 µL

ETS1 (Marker of Tumor Metastasis) (ETS1/1801), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LMO2 (B-Cell Marker) (LMO2/1971), CF568 conjugate, 0.1mg/mL
BNC681971-500 1x 500 µL

LMO2 (B-Cell Marker) (LMO2/1971), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DGKB (C-term) Rabbit Polyclonal Antibody
AP15094PU-N 400 µL

DGKB (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD64 Antibody[10.1]
E-AB-F1082L-01 20 Tests

Elab Fluor® 488 Anti-Human CD64 Antibody[10.1]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD64 Antibody[10.1]
E-AB-F1082L-02 100 Tests

Elab Fluor® 488 Anti-Human CD64 Antibody[10.1]

Sign In for Pricing
View Details