Recombinant Human Mitochondrial inner membrane organizing system protein 1 (MINOS1)
This Recombinant Human Mitochondrial inner membrane organizing system protein 1 (MINOS1) spans the amino acid sequence from region 1-78.
Product Specifications
Product Name Alternative
Mitochondrial inner membrane organizing system protein 1
UniProt
Q5TGZ0
Expression Region
1-78
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQH DFQAPYLLHGKYVKEQEQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
EKC2022 1 Kit, Containing two 96 Well Plates and all necessary reagents
Chk2 (Phospho-Thr387) Colorimetric Cell-Based ELISA Kit
Sign In for Pricing
View Details 
042702-AP 200 µL
TCHHL1, NT (TCHHL1, S100A17, THHL1, Trichohyalin-like protein 1, Basalin, Protein S100-A17, S100 calcium-binding protein A17) (AP) discontinued
Sign In for Pricing
View Details 