Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial inner membrane organizing system protein 1 (MINOS1)

This Recombinant Human Mitochondrial inner membrane organizing system protein 1 (MINOS1) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane organizing system protein 1

UniProt

Q5TGZ0

Expression Region

1-78

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQH DFQAPYLLHGKYVKEQEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC2A13 Rabbit Polyclonal Antibody
E10G33741 100 µL

SLC2A13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACTL6B Recombinant Protein (Mouse)
RP114047 100 µg

ACTL6B Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Perflexane
MBS3613939-01 5 mg

Perflexane

Sign In for Pricing
View Details
Perflexane
MBS3613939-02 5x 5 mg

Perflexane

Sign In for Pricing
View Details
KLHL13 (m) -PR
sc-146514-PR 10 µM - 20 µL

KLHL13 (m) -PR

Sign In for Pricing
View Details
Sheep Polyclonal BubR1 Antibody
NBP3-18818-250ug 250 µg

Sheep Polyclonal BubR1 Antibody

Sign In for Pricing
View Details