Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial inner membrane organizing system protein 1 (MINOS1)

This Recombinant Human Mitochondrial inner membrane organizing system protein 1 (MINOS1) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane organizing system protein 1

UniProt

Q5TGZ0

Expression Region

1-78

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQH DFQAPYLLHGKYVKEQEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Feline IgA Mouse Monoclonal Antibody [Clone ID: IgA9-6A]
SM1508P 250 µg

Feline IgA Mouse Monoclonal Antibody [Clone ID: IgA9-6A]

Sign In for Pricing
View Details
GPR171 AAV Vector (Mouse) (CMV)
22532104 1 µg

GPR171 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Tmco2 (NM_001081312) Mouse Recombinant Protein
PM42866M5 20 µg

Tmco2 (NM_001081312) Mouse Recombinant Protein

Sign In for Pricing
View Details
FBXW4P1 sgRNA CRISPR Lentivector (Human) (Target 3)
K0767404 1.0 µg DNA

FBXW4P1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
DAPK3 (Death Associated Protein Kinase 3, DLK, ZIP, ZIPK)
313054 100 µL

DAPK3 (Death Associated Protein Kinase 3, DLK, ZIP, ZIPK)

Sign In for Pricing
View Details
Empagliflozin Impurity 221
RM-E131821-01 10 mg

Empagliflozin Impurity 221

Sign In for Pricing
View Details