Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cryphonectria parasitica mycoreovirus 1 Uncharacterized protein VP11 (S11)

This Recombinant Cryphonectria parasitica mycoreovirus 1 Uncharacterized protein VP11 (S11) spans the amino acid sequence from region 24-101.

Product Specifications

Product Name Alternative

Uncharacterized protein VP11

UniProt

Q65YU5

Expression Region

24-101

Origin

Cryphonectria parasitica mycoreovirus 1 (strain 9B21) (CpMYRV-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IEDFDTHYTKKIREFLLFIIHTSCTMVAFIIGNLAMTRPRRTHHNTITAPDETIHDDILL PPAYKSLASAPALGIKMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 Spike Trimer Protein (N501Y, D614G), His Tag (MALS verified)
SPN-C52Hp-500ug 500 µg

SARS-CoV-2 Spike Trimer Protein (N501Y, D614G), His Tag (MALS verified)

Sign In for Pricing
View Details
CD99 / MIC2 (Ewing's Sarcoma Marker), 1mg/mL
BNUM1646-50 1x 50 µL

CD99 / MIC2 (Ewing's Sarcoma Marker), 1mg/mL

Sign In for Pricing
View Details
ARF1 Rabbit Monoclonal Antibody
TA422712 100 µL

ARF1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human IL-8/CXCL8 Protein
PKSH032656-01 20 µg

Recombinant Human IL-8/CXCL8 Protein

Sign In for Pricing
View Details
Recombinant Human IL-8/CXCL8 Protein
PKSH032656-02 100 µg

Recombinant Human IL-8/CXCL8 Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS627494 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details