Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cryphonectria parasitica mycoreovirus 1 Uncharacterized protein VP11 (S11)

This Recombinant Cryphonectria parasitica mycoreovirus 1 Uncharacterized protein VP11 (S11) spans the amino acid sequence from region 24-101.

Product Specifications

Product Name Alternative

Uncharacterized protein VP11

UniProt

Q65YU5

Expression Region

24-101

Origin

Cryphonectria parasitica mycoreovirus 1 (strain 9B21) (CpMYRV-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IEDFDTHYTKKIREFLLFIIHTSCTMVAFIIGNLAMTRPRRTHHNTITAPDETIHDDILL PPAYKSLASAPALGIKMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sucrose Octasulfate Potassium Salt
TRC-S699000-5G 5 g

Sucrose Octasulfate Potassium Salt

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (B22.1), CF488A conjugate, 0.1mg/mL
BNC881266-100 1x 100 µL

Cytokeratin 8 (KRT8) (B22.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Fibrillin-1/FBN1 Protein (His Tag)
PKSH033759-01 10 µg

Recombinant Human Fibrillin-1/FBN1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Fibrillin-1/FBN1 Protein (His Tag)
PKSH033759-02 50 µg

Recombinant Human Fibrillin-1/FBN1 Protein (His Tag)

Sign In for Pricing
View Details
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), 0.2mg/mL
BNUB2984-100 1x 100 µL

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), 0.2mg/mL

Sign In for Pricing
View Details
RFX1 (NM_002918) Human Over-expression Lysate
LY419021 100 µg

RFX1 (NM_002918) Human Over-expression Lysate

Sign In for Pricing
View Details