Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cryphonectria parasitica mycoreovirus 1 Uncharacterized protein VP11 (S11)

This Recombinant Cryphonectria parasitica mycoreovirus 1 Uncharacterized protein VP11 (S11) spans the amino acid sequence from region 24-101.

Product Specifications

Product Name Alternative

Uncharacterized protein VP11

UniProt

Q65YU5

Expression Region

24-101

Origin

Cryphonectria parasitica mycoreovirus 1 (strain 9B21) (CpMYRV-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IEDFDTHYTKKIREFLLFIIHTSCTMVAFIIGNLAMTRPRRTHHNTITAPDETIHDDILL PPAYKSLASAPALGIKMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pgp9.5 (UCHL-1) (31A3), CF594 conjugate, 0.1mg/mL
BNC940046-500 1x 500 µL

Pgp9.5 (UCHL-1) (31A3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NABC1 (BCAS1) Human Gene Knockout Kit (CRISPR)
KN423329 1 Kit

NABC1 (BCAS1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
epsilon-Poly-L-lysine Hydrochloride (Mn ~ 18,000 g/mol)
TRC-P688070-500MG 500 mg

epsilon-Poly-L-lysine Hydrochloride (Mn ~ 18,000 g/mol)

Sign In for Pricing
View Details
RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2702), CF647 conjugate, 0.1mg/mL
BNC472702-100 1x 100 µL

RAD51 (Prognostic and Response to Chemotherapy Marker) (RAD51/2702), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PI4KB (Center) Rabbit Polyclonal Antibody
AP17647PU-N 400 µL

PI4KB (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GGCT (NM_024051) Human Recombinant Protein
TP720189XL 1 mg

GGCT (NM_024051) Human Recombinant Protein

Sign In for Pricing
View Details