Recombinant Debaryomyces hansenii Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21)
This Recombinant Debaryomyces hansenii Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21) spans the amino acid sequence from region 1-78.
Product Specifications
Product Name Alternative
Vacuolar ATPase assembly integral membrane protein VMA21
UniProt
Q6BXM0
Expression Region
1-78
Origin
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MPADIPKSVVQKLVFFTAAMIICPVATFFICQYLFSNNAIISGGVSALVANIVLIGYVVA AFMEDTTEQEPEETKKSR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog