Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uncharacterized protein C17orf109 homolog

This Recombinant Mouse Uncharacterized protein C17orf109 homolog spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Uncharacterized protein C17orf109 homolog

UniProt

Q8BT42

Expression Region

1-78

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAATDFVGEIRSVGERLLLKLQQLPQAEPVELVAFSIIVLFTATVLVLGLIACSCCCAHC CCSESRQRKIPVRPTKPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CD45+ Cell Separation Kit (Trial)
K1304-10T 20 Tests

Mouse CD45+ Cell Separation Kit (Trial)

Sign In for Pricing
View Details
Atorvastatin calcium hydrate
C03351-250mg 250 mg

Atorvastatin calcium hydrate

Sign In for Pricing
View Details
Oligophrenin 1 Rabbit Polyclonal Antibody (BF594)
orb2544031 100 µL

Oligophrenin 1 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Phospho-RPS6KA1 (Thr359) Rabbit pAb
E47R5679 100 µL

Phospho-RPS6KA1 (Thr359) Rabbit pAb

Sign In for Pricing
View Details
PLK1 Protein (N-His, Mouse)
P527664 100 µg

PLK1 Protein (N-His, Mouse)

Sign In for Pricing
View Details
IRF1 (Interferon Regulatory Factor 1, IRF-1, MAR)
I7662-81E 50 µL

IRF1 (Interferon Regulatory Factor 1, IRF-1, MAR)

Sign In for Pricing
View Details