Recombinant Mycoplasma penetrans ATP synthase subunit c (atpE)
This Recombinant Mycoplasma penetrans ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-78.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
Q8EWZ3
Expression Region
1-78
Origin
Mycoplasma penetrans (strain HF-2)
Field of Research
Infectious Disease & Virology; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNITNQGYAFIGAGLAMIAILGVGIGQGWSAAKSVEAVARNPEVVSKIRSQYILSAAVTE TGALYCFIIAILLVFVAR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880096-100 1x 100 µL
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741231-500 1x 500 µL
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details