Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Uncharacterized protein PM1237 (PM1237)

This Recombinant Pasteurella multocida Uncharacterized protein PM1237 (PM1237) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Uncharacterized protein PM1237

UniProt

Q9CLJ2

Expression Region

1-78

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEQLKIKAMRAAGVGCVLMLMIIALVVFMLPTGILIDYLTLAGSWVGGGTTFGILMLAA LPPLTGAIFYYFWKWVLK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,3-Bis (diphenylphosphino) propane
263663-01 25 g

1,3-Bis (diphenylphosphino) propane

Sign In for Pricing
View Details
1,3-Bis (diphenylphosphino) propane
263663-02 50 g

1,3-Bis (diphenylphosphino) propane

Sign In for Pricing
View Details
1,3-Bis (diphenylphosphino) propane
263663-03 100 g

1,3-Bis (diphenylphosphino) propane

Sign In for Pricing
View Details
1,3-Bis (diphenylphosphino) propane
263663-04 250 g

1,3-Bis (diphenylphosphino) propane

Sign In for Pricing
View Details
1,3-Bis (diphenylphosphino) propane
263663-05 500 g

1,3-Bis (diphenylphosphino) propane

Sign In for Pricing
View Details
Anti-Human AP Endonuclease (APE/APEX/APE-1) antiserum #1
APE11-S 100 µL

Anti-Human AP Endonuclease (APE/APEX/APE-1) antiserum #1

Sign In for Pricing
View Details