Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atp6)

This Recombinant ATP synthase subunit a (atp6) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

P00853

Expression Region

1-78

Origin

Aspergillus amstelodami

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNLNFVLSPLDQFEVRDLLSINANLLGNFHLSLTNIGLYLTIGIFLILTYSLLATNNNK IIPNNWSISQESIYATVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH5A1 (NM_170740) Human Over-expression Lysate
LY406860 100 µg

ALDH5A1 (NM_170740) Human Over-expression Lysate

Sign In for Pricing
View Details
ZC3H10 Antibody
A64360-50UG 50 µg

ZC3H10 Antibody

Sign In for Pricing
View Details
Ebselen
MBS133494 Inquire

Ebselen

Sign In for Pricing
View Details
INHA Polyclonal Antibody
ANT-12815-100ug 100 µg

INHA Polyclonal Antibody

Sign In for Pricing
View Details
ZMAT1 (NM_032441) Human Over-expression Lysate
LC410135 20 µg

ZMAT1 (NM_032441) Human Over-expression Lysate

Sign In for Pricing
View Details
CaMKIIβ/γ/δ (Phospho Thr287) Monoclonal Antibody
E20-53524 100 µg

CaMKIIβ/γ/δ (Phospho Thr287) Monoclonal Antibody

Sign In for Pricing
View Details