Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized tatC-like protein ycf43 (ycf43)

This Recombinant Uncharacterized tatC-like protein ycf43 (ycf43) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Uncharacterized tatC-like protein ycf43

UniProt

P30160

Expression Region

1-78

Origin

Dictyota dichotoma

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALTRKPNNYLNFEFYSTRGINYSSFSLTELYSFEHFSEIRHRALYSLGFFLCTTIVIFS NIKFVVKILKNSVSMIQF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRGAP3 Rabbit Polyclonal Antibody
TA369369 100 µL

SRGAP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBE2O Protein Vector (Human) (pPB-N-His)
PV044974 500 ng

UBE2O Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Human Procollagen I¢ C-terminal Peptide (PI¢CP) ELISA Kit
CSB-E14938h-01 24 Well

Human Procollagen I¢ C-terminal Peptide (PI¢CP) ELISA Kit

Sign In for Pricing
View Details
Human Procollagen I¢ C-terminal Peptide (PI¢CP) ELISA Kit
CSB-E14938h-02 96 Well

Human Procollagen I¢ C-terminal Peptide (PI¢CP) ELISA Kit

Sign In for Pricing
View Details
Human Procollagen I¢ C-terminal Peptide (PI¢CP) ELISA Kit
CSB-E14938h-03 5x 96 Well

Human Procollagen I¢ C-terminal Peptide (PI¢CP) ELISA Kit

Sign In for Pricing
View Details
Human Procollagen I¢ C-terminal Peptide (PI¢CP) ELISA Kit
CSB-E14938h-04 10x 96 Well

Human Procollagen I¢ C-terminal Peptide (PI¢CP) ELISA Kit

Sign In for Pricing
View Details