Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized tatC-like protein ycf43 (ycf43)

This Recombinant Uncharacterized tatC-like protein ycf43 (ycf43) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Uncharacterized tatC-like protein ycf43

UniProt

P30160

Expression Region

1-78

Origin

Dictyota dichotoma

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALTRKPNNYLNFEFYSTRGINYSSFSLTELYSFEHFSEIRHRALYSLGFFLCTTIVIFS NIKFVVKILKNSVSMIQF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD147 / EMMPRIN / Basigin Protein
MBS2546435-01 0.05 mg

Recombinant Human CD147 / EMMPRIN / Basigin Protein

Sign In for Pricing
View Details
Recombinant Human CD147 / EMMPRIN / Basigin Protein
MBS2546435-02 5x 0.05 mg

Recombinant Human CD147 / EMMPRIN / Basigin Protein

Sign In for Pricing
View Details
Recombinant Mouse Sele Protein, His (Fc)-Avi-tagged
Sele-164M 50 µg

Recombinant Mouse Sele Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Host cell factor C1 reguLator 1 (HCFC1R1) (NM_017885) Human Untagged Clone
SC321970 10 µg

Host cell factor C1 reguLator 1 (HCFC1R1) (NM_017885) Human Untagged Clone

Sign In for Pricing
View Details
Topoisomerase I, Mitochondrial (TOP1MT) Polyclonal Antibody
CAU23082-01 100 µL

Topoisomerase I, Mitochondrial (TOP1MT) Polyclonal Antibody

Sign In for Pricing
View Details
Topoisomerase I, Mitochondrial (TOP1MT) Polyclonal Antibody
CAU23082-02 200 µL

Topoisomerase I, Mitochondrial (TOP1MT) Polyclonal Antibody

Sign In for Pricing
View Details