Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized tatC-like protein ycf43 (ycf43)

This Recombinant Uncharacterized tatC-like protein ycf43 (ycf43) spans the amino acid sequence from region 1-78.

Product Specifications

Product Name Alternative

Uncharacterized tatC-like protein ycf43

UniProt

P30160

Expression Region

1-78

Origin

Dictyota dichotoma

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALTRKPNNYLNFEFYSTRGINYSSFSLTELYSFEHFSEIRHRALYSLGFFLCTTIVIFS NIKFVVKILKNSVSMIQF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1H-Indole-3-boronic acid, pinacol ester
OR305200-01 100 mg

1H-Indole-3-boronic acid, pinacol ester

Sign In for Pricing
View Details
1H-Indole-3-boronic acid, pinacol ester
OR305200-02 250 mg

1H-Indole-3-boronic acid, pinacol ester

Sign In for Pricing
View Details
1H-Indole-3-boronic acid, pinacol ester
OR305200-03 1 g

1H-Indole-3-boronic acid, pinacol ester

Sign In for Pricing
View Details
1H-Indole-3-boronic acid, pinacol ester
OR305200-04 5 g

1H-Indole-3-boronic acid, pinacol ester

Sign In for Pricing
View Details
1H-Indole-3-boronic acid, pinacol ester
OR305200-05 25 g

1H-Indole-3-boronic acid, pinacol ester

Sign In for Pricing
View Details
NOG (Noggin) (AP)
MBS6132613-01 0.1 mL

NOG (Noggin) (AP)

Sign In for Pricing
View Details