Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Feline enteric coronavirus Non-structural 7a protein (7a)

This Recombinant Feline enteric coronavirus Non-structural 7a protein (7a) spans the amino acid sequence from region 24-101.

Product Specifications

Product Name Alternative

Non-structural 7a protein, ns7a, 11 kDa protein, Accessory protein 7a

UniProt

P33465

Expression Region

24-101

Origin

Feline enteric coronavirus (strain 79-1683) (FeCoV) (FECV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LERLLLSHLLNLTTVSNVLGVPDSSLRVNCLQLLKPDCLDFNILHKVLAETRLLVVVLRV IFLVLLGFSCYTLLGALF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHFR (NM_000791) Human Over-expression Lysate
LS001719-20ug 20 µg

DHFR (NM_000791) Human Over-expression Lysate

Sign In for Pricing
View Details
WDR90 (NM_145294) Human Over-expression Lysate
LC408015 20 µg

WDR90 (NM_145294) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Streptococcus pyogenes Cas9 Protein, N-His
AP97994 50 µg

Recombinant Streptococcus pyogenes Cas9 Protein, N-His

Sign In for Pricing
View Details
Goat anti Mouse IgG3 Antibody (HRP)
abx239828-01 100 µL

Goat anti Mouse IgG3 Antibody (HRP)

Sign In for Pricing
View Details
Goat anti Mouse IgG3 Antibody (HRP)
abx239828-02 500 µL

Goat anti Mouse IgG3 Antibody (HRP)

Sign In for Pricing
View Details
IHH antibody
39054-01 50 µL

IHH antibody

Sign In for Pricing
View Details