Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Feline enteric coronavirus Non-structural 7a protein (7a)

This Recombinant Feline enteric coronavirus Non-structural 7a protein (7a) spans the amino acid sequence from region 24-101.

Product Specifications

Product Name Alternative

Non-structural 7a protein, ns7a, 11 kDa protein, Accessory protein 7a

UniProt

P33465

Expression Region

24-101

Origin

Feline enteric coronavirus (strain 79-1683) (FeCoV) (FECV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LERLLLSHLLNLTTVSNVLGVPDSSLRVNCLQLLKPDCLDFNILHKVLAETRLLVVVLRV IFLVLLGFSCYTLLGALF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Formylphenoxyacetic acid
OR1043409-01 250 mg

3-Formylphenoxyacetic acid

Sign In for Pricing
View Details
3-Formylphenoxyacetic acid
OR1043409-02 1 g

3-Formylphenoxyacetic acid

Sign In for Pricing
View Details
3-Formylphenoxyacetic acid
OR1043409-03 5 g

3-Formylphenoxyacetic acid

Sign In for Pricing
View Details
3-Formylphenoxyacetic acid
OR1043409-04 10 g

3-Formylphenoxyacetic acid

Sign In for Pricing
View Details
3-Formylphenoxyacetic acid
OR1043409-05 25 g

3-Formylphenoxyacetic acid

Sign In for Pricing
View Details
3-Formylphenoxyacetic acid
OR1043409-06 50 g

3-Formylphenoxyacetic acid

Sign In for Pricing
View Details