Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Canine coronavirus Non-structural protein 7a (7a)

This Recombinant Canine coronavirus Non-structural protein 7a (7a) spans the amino acid sequence from region 24-101.

Product Specifications

Product Name Alternative

Non-structural protein 7a, ns7a, 11 kDa protein, Accessory protein 7a, X3 protein

UniProt

P36301

Expression Region

24-101

Origin

Canine coronavirus (strain Insavc-1) (CCoV) (Canine enteric coronavirus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LERLLLNHSLNLKTVNNVLGVTHTGLKVNCLQLLKPDCLDFNILHRSLAETRLLKVVLRV IFLVLLGFCCYRLLVTLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NKPD1 activation kit by CRISPRa
GA117129 1 Kit

Human NKPD1 activation kit by CRISPRa

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker), CF568 conjugate, 0.1mg/mL
BNC681662-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human beta Defensin 3 (DEFB103A) activation kit by CRISPRa
GA118411 1 Kit

Human beta Defensin 3 (DEFB103A) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse CCL12 Protein (Trx Tag)
PDEM100197-01 20 µg

Recombinant Mouse CCL12 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse CCL12 Protein (Trx Tag)
PDEM100197-02 100 µg

Recombinant Mouse CCL12 Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Mouse CCL12 Protein (Trx Tag)
PDEM100197-03 500 µg

Recombinant Mouse CCL12 Protein (Trx Tag)

Sign In for Pricing
View Details