Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Canine coronavirus Non-structural protein 7a (7a)

This Recombinant Canine coronavirus Non-structural protein 7a (7a) spans the amino acid sequence from region 24-101.

Product Specifications

Product Name Alternative

Non-structural protein 7a, ns7a, 11 kDa protein, Accessory protein 7a, X3 protein

UniProt

P36301

Expression Region

24-101

Origin

Canine coronavirus (strain Insavc-1) (CCoV) (Canine enteric coronavirus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LERLLLNHSLNLKTVNNVLGVTHTGLKVNCLQLLKPDCLDFNILHRSLAETRLLKVVLRV IFLVLLGFCCYRLLVTLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC102641613 Mouse Monoclonal Antibody [Clone ID: 34-5-8S]
CL053P 250 µg

LOC102641613 Mouse Monoclonal Antibody [Clone ID: 34-5-8S]

Sign In for Pricing
View Details
Ribonuclease Inhibitor (RNH1) (NM_203386) Human Recombinant Protein
TP318365 20 µg

Ribonuclease Inhibitor (RNH1) (NM_203386) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS506995 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
CKS2 Antibody
8C10543-AAT 50 µg

CKS2 Antibody

Sign In for Pricing
View Details
SensiStain™ Anti-Cytokeratin 18 Antibody
HY000095 0.1 mL

SensiStain™ Anti-Cytokeratin 18 Antibody

Sign In for Pricing
View Details
3-Azido-3-deoxy-1,2:5,6-di-O-isopropylidene-Alpha-D-glucofuranose
TRC-A824000-250MG 250 mg

3-Azido-3-deoxy-1,2:5,6-di-O-isopropylidene-Alpha-D-glucofuranose

Sign In for Pricing
View Details