Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Canine coronavirus Non-structural protein 7a (7a)

This Recombinant Canine coronavirus Non-structural protein 7a (7a) spans the amino acid sequence from region 24-101.

Product Specifications

Product Name Alternative

Non-structural protein 7a, ns7a, 11 kDa protein, Accessory protein 7a, X3 protein

UniProt

P36301

Expression Region

24-101

Origin

Canine coronavirus (strain Insavc-1) (CCoV) (Canine enteric coronavirus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LERLLLNHSLNLKTVNNVLGVTHTGLKVNCLQLLKPDCLDFNILHRSLAETRLLKVVLRV IFLVLLGFCCYRLLVTLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

c-Jun (JUN) pThr93 Rabbit Polyclonal Antibody
AP02323PU-N 100 µL

c-Jun (JUN) pThr93 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PU.1 (SPI-1) (B-Cell Marker) (PU1/2146), 1mg/mL
BNUM2146-50 1x 50 µL

PU.1 (SPI-1) (B-Cell Marker) (PU1/2146), 1mg/mL

Sign In for Pricing
View Details
Ckap4 Mouse Gene Knockout Kit (CRISPR)
KN503371 1 Kit

Ckap4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NRXN3 Rabbit Polyclonal Antibody
TA379323 100 µL

NRXN3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD54 Antibody[YN1/1.7.4]
E-AB-F1018UI-01 25 µg

PE/Cyanine5.5 Anti-Mouse CD54 Antibody[YN1/1.7.4]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD54 Antibody[YN1/1.7.4]
E-AB-F1018UI-02 100 µg

PE/Cyanine5.5 Anti-Mouse CD54 Antibody[YN1/1.7.4]

Sign In for Pricing
View Details