Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum ATP synthase subunit c (atpE)
This Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
P57119
Expression Region
1-79
Origin
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MENLNVDMLYIAVAIMVGLASIGAAIGIGILGGKFLEGAARQPDLVPLLRTQFFVVMGLV DAIPMIAVGLGLYMLFAIS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740750-500 1x 500 µL
CD8 (C8/468 + C8/144B), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740920-500 1x 500 µL
Myosin, Smooth Muscle Heavy Chain (ID8), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details