Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yeiS (yeiS)

This Recombinant Uncharacterized protein yeiS (yeiS) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Uncharacterized protein yeiS

UniProt

P64537

Expression Region

1-79

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVQQFFVVAVFFLIPIFCFREAWKGWRAGAIDKRVKNAPEPVYVWRAKNPGLFFAYMVA YIGFGILSIGMIVYLIFYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (2- ((3-Fluorophenoxy) methyl) phenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane
PC101429-01 100 mg

2- (2- ((3-Fluorophenoxy) methyl) phenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane

Sign In for Pricing
View Details
2- (2- ((3-Fluorophenoxy) methyl) phenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane
PC101429-02 250 mg

2- (2- ((3-Fluorophenoxy) methyl) phenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane

Sign In for Pricing
View Details
2- (2- ((3-Fluorophenoxy) methyl) phenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane
PC101429-03 1 g

2- (2- ((3-Fluorophenoxy) methyl) phenyl) -4,4,5,5-tetramethyl-1,3,2-dioxaborolane

Sign In for Pricing
View Details
IL2RG Recombinant Protein
OPCD04409-200UG 200 µg

IL2RG Recombinant Protein

Sign In for Pricing
View Details
SERPINA3 Rabbit pAb
E2502803 100 µL

SERPINA3 Rabbit pAb

Sign In for Pricing
View Details
Lmod1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4840107 1.0 µg DNA

Lmod1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details