Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yeiS (yeiS)

This Recombinant Uncharacterized protein yeiS (yeiS) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Uncharacterized protein yeiS

UniProt

P64537

Expression Region

1-79

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVQQFFVVAVFFLIPIFCFREAWKGWRAGAIDKRVKNAPEPVYVWRAKNPGLFFAYMVA YIGFGILSIGMIVYLIFYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CCDC99 Antibody [PerCP]
NB100-61595PCP 0.1 mL

Rabbit Polyclonal CCDC99 Antibody [PerCP]

Sign In for Pricing
View Details
Anti-Zebrafish UBE2Ia/b Antibody Picoband® Fluoro594 Conjugated
AZQ9W6H5-Fluoro594 100 µg/Vial

Anti-Zebrafish UBE2Ia/b Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Rabbit anti-FKBPL Antibody
DL94573A-01 50 µL

Rabbit anti-FKBPL Antibody

Sign In for Pricing
View Details
Rabbit anti-FKBPL Antibody
DL94573A-02 100 µL

Rabbit anti-FKBPL Antibody

Sign In for Pricing
View Details
Anti-S100A7 Polyclonal Antibody
TMAB-12455-01 50 μL

Anti-S100A7 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-S100A7 Polyclonal Antibody
TMAB-12455-02 100 µL

Anti-S100A7 Polyclonal Antibody

Sign In for Pricing
View Details