Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yeiS (yeiS)

This Recombinant Uncharacterized protein yeiS (yeiS) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Uncharacterized protein yeiS

UniProt

P64538

Expression Region

1-79

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVQQFFVVAVFFLIPIFCFREAWKGWRAGAIDKRVKNAPEPVYVWRAKNPGLFFAYMVA YIGFGILSIGMIVYLIFYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIS1 Antibody / Lissencephaly 1
R36182-100UG 100 µg

LIS1 Antibody / Lissencephaly 1

Sign In for Pricing
View Details
Human ZNF133 (NM_001083330) AAV Particle
RC223016A1V 250 µL

Human ZNF133 (NM_001083330) AAV Particle

Sign In for Pricing
View Details
F13a1 (NM_021698) Rat Tagged Lenti ORF Clone
RR210803L4 10 µg

F13a1 (NM_021698) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human PARVG Protein Lysate 20ug
IHUPARVGPLLY20UG 20 µg

Human PARVG Protein Lysate 20ug

Sign In for Pricing
View Details
FAM200A Adenovirus (Human)
19917051 1.0 mL

FAM200A Adenovirus (Human)

Sign In for Pricing
View Details
Vinculin (VCL) Rabbit Polyclonal Antibody
TA347873 100 µg

Vinculin (VCL) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details