Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yeiS (yeiS)

This Recombinant Uncharacterized protein yeiS (yeiS) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Uncharacterized protein yeiS

UniProt

P64538

Expression Region

1-79

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVQQFFVVAVFFLIPIFCFREAWKGWRAGAIDKRVKNAPEPVYVWRAKNPGLFFAYMVA YIGFGILSIGMIVYLIFYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSRP1 Rabbit pAb
E45R18247N 50 ul

CSRP1 Rabbit pAb

Sign In for Pricing
View Details
Rab9 (RAB9A) Human Over-expression Lysate
orb1378184 20 µg

Rab9 (RAB9A) Human Over-expression Lysate

Sign In for Pricing
View Details
Phospho-AKT1 (S246) Antibody
A10923-50UG 50 µg

Phospho-AKT1 (S246) Antibody

Sign In for Pricing
View Details
OR4C6 (NM_001004704) Human Untagged Clone
SC300747 10 µg

OR4C6 (NM_001004704) Human Untagged Clone

Sign In for Pricing
View Details
Rabbit CAAX prenyl protease 2 (RCE1) ELISA Kit
MBS7243126-01 48 Well

Rabbit CAAX prenyl protease 2 (RCE1) ELISA Kit

Sign In for Pricing
View Details
Rabbit CAAX prenyl protease 2 (RCE1) ELISA Kit
MBS7243126-02 96 Well

Rabbit CAAX prenyl protease 2 (RCE1) ELISA Kit

Sign In for Pricing
View Details