Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yeiS (yeiS)

This Recombinant Uncharacterized protein yeiS (yeiS) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Uncharacterized protein yeiS

UniProt

P64538

Expression Region

1-79

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVQQFFVVAVFFLIPIFCFREAWKGWRAGAIDKRVKNAPEPVYVWRAKNPGLFFAYMVA YIGFGILSIGMIVYLIFYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBC Lysis Buffer
18-448 125 mL/Unit

RBC Lysis Buffer

Sign In for Pricing
View Details
Rabbit Polyclonal TTLL7 Antibody
NBP2-49038-25ul 25 µL

Rabbit Polyclonal TTLL7 Antibody

Sign In for Pricing
View Details
Recombinant Human NRG1-beta 1/HRG1-beta 1 His Protein CF
11422-NR-100 100 µg

Recombinant Human NRG1-beta 1/HRG1-beta 1 His Protein CF

Sign In for Pricing
View Details
Human UTP23 Recombinant Protein
PROTQ9BRU9-100ug 100 µg

Human UTP23 Recombinant Protein

Sign In for Pricing
View Details
Anti-LACTB Antibody Picoband®, iFluor647 Conjugate
A13145-1-iFluor647 100 µg

Anti-LACTB Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
CTD small Phosphatase-Like protein (CTDSPL) Mouse ELISA Kit
C6397 96 Tests

CTD small Phosphatase-Like protein (CTDSPL) Mouse ELISA Kit

Sign In for Pricing
View Details