Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pestis ATP synthase subunit c (atpE)

This Recombinant Yersinia pestis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A4TSI8

Expression Region

1-79

Origin

Yersinia pestis (strain Pestoides F)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PASD5 (NPAS1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F3]
TA809541AM 100 µL

PASD5 (NPAS1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F3]

Sign In for Pricing
View Details
Zymostenol
TRC-Z701530-50MG 50 mg

Zymostenol

Sign In for Pricing
View Details
Human FLVCR (FLVCR1) activation kit by CRISPRa
GA109187 1 Kit

Human FLVCR (FLVCR1) activation kit by CRISPRa

Sign In for Pricing
View Details
LRTOMT (NM_001145308) Human Over-expression Lysate
LY428811 100 µg

LRTOMT (NM_001145308) Human Over-expression Lysate

Sign In for Pricing
View Details
DOK2 pTyr299 Rabbit Polyclonal Antibody
AP02521PU-S 50 µL

DOK2 pTyr299 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SuLfatase 2 (SuLF2) (NM_001161841) Human Over-expression Lysate
LC432060 20 µg

SuLfatase 2 (SuLF2) (NM_001161841) Human Over-expression Lysate

Sign In for Pricing
View Details