Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum ATP synthase subunit c (atpE)

This Recombinant Clostridium botulinum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A5HY47

Expression Region

1-79

Origin

Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPKAFVSGMAALGAGIAALACIGAGIGTGNATGKAVEGVSRQPEASGKIMSTLVIGSAF SEATAIYGLIIALFLIFKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Direct Blue 6 (Technical Grade)
TRC-D492950-250MG 250 mg

Direct Blue 6 (Technical Grade)

Sign In for Pricing
View Details
Cortisol 21-Mesylate
TRC-C696325-250MG 250 mg

Cortisol 21-Mesylate

Sign In for Pricing
View Details
Clostebol
TRC-C587430-10MG 10 mg

Clostebol

Sign In for Pricing
View Details
Mini Sample Mouse CTSS (Cathepsin S) ELISA Kit
E-MSEL-M0025-01 24 Tests

Mini Sample Mouse CTSS (Cathepsin S) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse CTSS (Cathepsin S) ELISA Kit
E-MSEL-M0025-02 48 Tests

Mini Sample Mouse CTSS (Cathepsin S) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse CTSS (Cathepsin S) ELISA Kit
E-MSEL-M0025-03 96 Tests

Mini Sample Mouse CTSS (Cathepsin S) ELISA Kit

Sign In for Pricing
View Details