Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum ATP synthase subunit c (atpE)

This Recombinant Clostridium botulinum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A5HY47

Expression Region

1-79

Origin

Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPKAFVSGMAALGAGIAALACIGAGIGTGNATGKAVEGVSRQPEASGKIMSTLVIGSAF SEATAIYGLIIALFLIFKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Enhancer Of Zeste Homolog 1 (EZH1) ELISA Kit
RD-EZH1-Hu-01 96 Tests

Human Enhancer Of Zeste Homolog 1 (EZH1) ELISA Kit

Sign In for Pricing
View Details
Human Enhancer Of Zeste Homolog 1 (EZH1) ELISA Kit
RD-EZH1-Hu-02 48 Tests

Human Enhancer Of Zeste Homolog 1 (EZH1) ELISA Kit

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF640R conjugate, 0.1mg/mL
BNC402332-500 1x 500 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Plant Root Activity Assay Kit
E-BC-K855-S 100 Assays (43 samples)

Plant Root Activity Assay Kit

Sign In for Pricing
View Details
Phenyl Acetate
TRC-P319150-50G 50 g

Phenyl Acetate

Sign In for Pricing
View Details
Rbfox1 Rabbit Polyclonal Antibody
TA363212 100 µL

Rbfox1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details