Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative transmembrane protein LOC100289255

This Recombinant Human Putative transmembrane protein LOC100289255 spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Putative transmembrane protein LOC100289255

UniProt

A6NJY4

Expression Region

1-79

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLGSLWGRCHPGCCALFLILALLLDAVGLVLLLLGILAPLSSWDFFIYTGALILALSLL LWIIWYSLNIEVSPEKLDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALCAM Protein Vector (Rat) (pPM-C-HA)
11720026 500 ng

ALCAM Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Tppp ORF Vector (Mouse) (pORF)
47384014 1.0 µg DNA

Tppp ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal IL-33 Antibody (6H617) [HRP]
NBP2-27333H 0.1 mL

Mouse Monoclonal IL-33 Antibody (6H617) [HRP]

Sign In for Pricing
View Details
MICAL1 polyclonal antibody
BS72615-01 50 µL

MICAL1 polyclonal antibody

Sign In for Pricing
View Details
MICAL1 polyclonal antibody
BS72615-02 100 µL

MICAL1 polyclonal antibody

Sign In for Pricing
View Details
Fish Intermediate Density Lipoprotein (IDL) ELISA Kit
MBS9913582 Inquire

Fish Intermediate Density Lipoprotein (IDL) ELISA Kit

Sign In for Pricing
View Details