Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative transmembrane protein LOC100289255

This Recombinant Human Putative transmembrane protein LOC100289255 spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

Putative transmembrane protein LOC100289255

UniProt

A6NJY4

Expression Region

1-79

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLGSLWGRCHPGCCALFLILALLLDAVGLVLLLLGILAPLSSWDFFIYTGALILALSLL LWIIWYSLNIEVSPEKLDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Fluorobenzoic Acid, Methyl Ester
F5261-30 1 g

3-Fluorobenzoic Acid, Methyl Ester

Sign In for Pricing
View Details
Protein phosphatase1α(PP1α)
MA1086-S 100μg

Protein phosphatase1α(PP1α)

Sign In for Pricing
View Details
Fas Rabbit Polyclonal Antibody (Carrier-free)
orb3078265 100 µg

Fas Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Rat Inositol Polyphosphate Multikinase (IPMK) ELISA Kit
abx391484 96 Tests

Rat Inositol Polyphosphate Multikinase (IPMK) ELISA Kit

Sign In for Pricing
View Details
CRYGB Rabbit Polyclonal Antibody (RBITC)
orb1064044 100 µL

CRYGB Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Mouse Tram1l1 Pre-designed siRNA Set B
SI115165B 1 Each

Mouse Tram1l1 Pre-designed siRNA Set B

Sign In for Pricing
View Details