Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cronobacter sakazakii ATP synthase subunit c (atpE)

This Recombinant Cronobacter sakazakii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A7MMV9

Expression Region

1-79

Origin

Cronobacter sakazakii (strain ATCC BAA-894) (Enterobacter sakazakii)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha 2 Glycine Receptor (GLRA2) (NM_001118885) Human Over-expression Lysate
LC426527 20 µg

alpha 2 Glycine Receptor (GLRA2) (NM_001118885) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Sialidase 2, Cytosolic (SIAL2) ELISA Kit
RDR-SIAL2-Mu-01 96 Tests

Mouse Sialidase 2, Cytosolic (SIAL2) ELISA Kit

Sign In for Pricing
View Details
Mouse Sialidase 2, Cytosolic (SIAL2) ELISA Kit
RDR-SIAL2-Mu-02 48 Tests

Mouse Sialidase 2, Cytosolic (SIAL2) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS634143 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
C6ORF154 (LRRC73) (NM_001012974) Human Recombinant Protein
TP311055M 100 µg

C6ORF154 (LRRC73) (NM_001012974) Human Recombinant Protein

Sign In for Pricing
View Details
rac-Bunolol Hydrochloride
TRC-B689660-50MG 50 mg

rac-Bunolol Hydrochloride

Sign In for Pricing
View Details