Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum ATP synthase subunit c (atpE)

This Recombinant Clostridium botulinum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A7FQH4

Expression Region

1-79

Origin

Clostridium botulinum (strain ATCC 19397 / Type A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPKAFVSGMAALGAGIAALACIGAGIGTGNATGKAVEGVSRQPEASGKIMSTLVIGSAF SEATAIYGLIIALFLIFKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

c8orf84 (SBSPON) (NM_153225) Human Over-expression Lysate
LY432161 100 µg

c8orf84 (SBSPON) (NM_153225) Human Over-expression Lysate

Sign In for Pricing
View Details
NLRC5 Human Gene Knockout Kit (CRISPR)
KN214810 1 Kit

NLRC5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
S100P Rabbit Polyclonal Antibody
TA364993 100 µL

S100P Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Mouse IgG2a, κ Isotype Control
RD22451F-01 25 µg

PerCP/Cyanine5.5 Mouse IgG2a, κ Isotype Control

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Mouse IgG2a, κ Isotype Control
RD22451F-02 100 µg

PerCP/Cyanine5.5 Mouse IgG2a, κ Isotype Control

Sign In for Pricing
View Details
CNN2 Mouse Monoclonal Antibody [Clone ID: 24H5]
TA399876 0.2 mg

CNN2 Mouse Monoclonal Antibody [Clone ID: 24H5]

Sign In for Pricing
View Details