Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype O:1b ATP synthase subunit c (atpE)

This Recombinant Yersinia pseudotuberculosis serotype O:1b ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A7FPE5

Expression Region

1-79

Origin

Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Palladium On Carbon (extent of labeling: 10 wt. % loading, matrix carbon, dry support)
TRC-P141075-2.5G 2.5 g

Palladium On Carbon (extent of labeling: 10 wt. % loading, matrix carbon, dry support)

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (CPTC-HSPD1-1), CF568 conjugate, 0.1mg/mL
BNC682245-500 1x 500 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (CPTC-HSPD1-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ubiquinol Cytochrome C Reductase Core Protein I (UQCRC1) Rabbit Polyclonal Antibody
TA383126 100 µL

Ubiquinol Cytochrome C Reductase Core Protein I (UQCRC1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RHOXF1 Human Gene Knockout Kit (CRISPR)
KN417618 1 Kit

RHOXF1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MRPS34 Antibody
8C16662-AAT 50 µg

MRPS34 Antibody

Sign In for Pricing
View Details
MACC1 Rabbit Polyclonal Antibody
TA367125 100 µL

MACC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details