Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serratia proteamaculans ATP synthase subunit c (atpE)

This Recombinant Serratia proteamaculans ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A8G7M3

Expression Region

1-79

Origin

Serratia proteamaculans (strain 568)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLSMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GAD65/GAD2 Antibody Picoband®
A03142 100 µg/Vial

Anti-GAD65/GAD2 Antibody Picoband®

Sign In for Pricing
View Details
Pou2f3 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7106204 1.0 µg DNA

Pou2f3 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Terb2 (NM_028914) Mouse Tagged ORF Clone
MG214398 10 µg

Terb2 (NM_028914) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rat IgG2b Isotype Control BG Violet 450
MBS697123-01 0.1 mg

Rat IgG2b Isotype Control BG Violet 450

Sign In for Pricing
View Details
Rat IgG2b Isotype Control BG Violet 450
MBS697123-02 5x 0.1 mg

Rat IgG2b Isotype Control BG Violet 450

Sign In for Pricing
View Details
Rhotekin (h) : 293T Lysate
sc-112761 100 µg - 200 µL

Rhotekin (h) : 293T Lysate

Sign In for Pricing
View Details