Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serratia proteamaculans ATP synthase subunit c (atpE)

This Recombinant Serratia proteamaculans ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A8G7M3

Expression Region

1-79

Origin

Serratia proteamaculans (strain 568)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLSMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNIP2 Rabbit pAb
E2507100 100 µL

KCNIP2 Rabbit pAb

Sign In for Pricing
View Details
Mouse FOXO3 (Forkhead Box Protein O3) ELISA Kit
MBS8802567-01 48 Well

Mouse FOXO3 (Forkhead Box Protein O3) ELISA Kit

Sign In for Pricing
View Details
Mouse FOXO3 (Forkhead Box Protein O3) ELISA Kit
MBS8802567-02 96 Well

Mouse FOXO3 (Forkhead Box Protein O3) ELISA Kit

Sign In for Pricing
View Details
Mouse FOXO3 (Forkhead Box Protein O3) ELISA Kit
MBS8802567-03 5x 96 Well

Mouse FOXO3 (Forkhead Box Protein O3) ELISA Kit

Sign In for Pricing
View Details
Mouse FOXO3 (Forkhead Box Protein O3) ELISA Kit
MBS8802567-04 10x 96 Well

Mouse FOXO3 (Forkhead Box Protein O3) ELISA Kit

Sign In for Pricing
View Details
CD50 Recombinant Antibody, Cy3 Conjugated
bsm-60619R-Cy3 100 µL

CD50 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details