Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serratia proteamaculans ATP synthase subunit c (atpE)

This Recombinant Serratia proteamaculans ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A8G7M3

Expression Region

1-79

Origin

Serratia proteamaculans (strain 568)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLSMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IP3KC Lentiviral Activation Particles (h)
sc-408964-LAC 200 µL

IP3KC Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
FANCF (Fanconi Anemia Group B Protein, Protein FACB, Fanconi Anemia-associated Polypeptide of 95kD, FAAP95, MGC126856) (Biotin)
MBS6141840-01 0.1 mL

FANCF (Fanconi Anemia Group B Protein, Protein FACB, Fanconi Anemia-associated Polypeptide of 95kD, FAAP95, MGC126856) (Biotin)

Sign In for Pricing
View Details
FANCF (Fanconi Anemia Group B Protein, Protein FACB, Fanconi Anemia-associated Polypeptide of 95kD, FAAP95, MGC126856) (Biotin)
MBS6141840-02 5x 0.1 mL

FANCF (Fanconi Anemia Group B Protein, Protein FACB, Fanconi Anemia-associated Polypeptide of 95kD, FAAP95, MGC126856) (Biotin)

Sign In for Pricing
View Details
NDUFA9 discontinued
392037 200 µL

NDUFA9 discontinued

Sign In for Pricing
View Details
Recombinant Human Airway Trypsin-Like Protease 5/HATL5/TMPRSS11B (C-6His)
C821-50ug 50 µg

Recombinant Human Airway Trypsin-Like Protease 5/HATL5/TMPRSS11B (C-6His)

Sign In for Pricing
View Details
Nox4 (NM_015760) Mouse Tagged Lenti ORF Clone
MR227192L2 10 µg

Nox4 (NM_015760) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details