Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O9:H4 ATP synthase subunit c (atpE)

This Recombinant Escherichia coli O9:H4 ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A8A6K0

Expression Region

1-79

Origin

Escherichia coli O9:H4 (strain HS)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL
BNC041429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL
BNC940031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
BNC040204-100 1x 100 µL

Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF640R conjugate, 0.1mg/mL
BNC401803-500 1x 500 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF740 conjugate, 0.1mg/mL
BNC742899-500 1x 500 µL

Alkaline Phosphatase (Placental) / PLAP (Germ Cell Tumor Marker) (ALPP/2899R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2-Microglobulin (B2M) (B2M/1118), CF594 conjugate, 0.1mg/mL
BNC941118-500 1x 500 µL

Beta-2-Microglobulin (B2M) (B2M/1118), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details