Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cellvibrio japonicus ATP synthase subunit c (atpE)

This Recombinant Cellvibrio japonicus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B3PIT2

Expression Region

1-79

Origin

Cellvibrio japonicus (strain Ueda107) (Pseudomonas fluorescens subsp. cellulosa)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEAAALIILAGALVIGLGAIGAAIGVALLGGKFLEGAARQPELLPMLRTQFFVVMGLVD AIPMIGVGIGMYILFALGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FADS1 Mouse Monoclonal Antibody [Clone ID: 2D9]
AM31762PU-N 50 µg

FADS1 Mouse Monoclonal Antibody [Clone ID: 2D9]

Sign In for Pricing
View Details
Xanthorrhizol (Technical grade)
TRC-X742075-25MG 25 mg

Xanthorrhizol (Technical grade)

Sign In for Pricing
View Details
GMP Human IL-18 Protein
GMP-L18H16-500ug 500 µg

GMP Human IL-18 Protein

Sign In for Pricing
View Details
2'-Hydroxyflavone
TRC-H942478-500MG 500 mg

2'-Hydroxyflavone

Sign In for Pricing
View Details
10H-Phenothiazine 5-Oxide
TRC-P318098-50MG 50 mg

10H-Phenothiazine 5-Oxide

Sign In for Pricing
View Details
Recombinant Human Osteocalcin/BGP protein (GST tag)
PDEH100785-01 20 µg

Recombinant Human Osteocalcin/BGP protein (GST tag)

Sign In for Pricing
View Details