Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cellvibrio japonicus ATP synthase subunit c (atpE)

This Recombinant Cellvibrio japonicus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B3PIT2

Expression Region

1-79

Origin

Cellvibrio japonicus (strain Ueda107) (Pseudomonas fluorescens subsp. cellulosa)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEAAALIILAGALVIGLGAIGAAIGVALLGGKFLEGAARQPELLPMLRTQFFVVMGLVD AIPMIGVGIGMYILFALGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIX1 (NM_005982) Human Over-expression Lysate
LY401814 100 µg

SIX1 (NM_005982) Human Over-expression Lysate

Sign In for Pricing
View Details
SREBP2 (SREBP2/1579), Biotin conjugate, 0.1mg/mL
BNCB1579-500 1x 500 µL

SREBP2 (SREBP2/1579), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DTWD1 Human qPCR Primer Pair (NM_001144955)
HP232556 200 Reactions

DTWD1 Human qPCR Primer Pair (NM_001144955)

Sign In for Pricing
View Details
OR2V2 Human Gene Knockout Kit (CRISPR)
KN423132 1 Kit

OR2V2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ASB14 (NM_001142733) Human Over-expression Lysate
LY428258 100 µg

ASB14 (NM_001142733) Human Over-expression Lysate

Sign In for Pricing
View Details
CD79A (208-222) Mouse Monoclonal Antibody [Clone ID: HM47]
AM26759PU-N 100 µg

CD79A (208-222) Mouse Monoclonal Antibody [Clone ID: HM47]

Sign In for Pricing
View Details