Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella boydii serotype 18 ATP synthase subunit c (atpE)

This Recombinant Shigella boydii serotype 18 ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B2TUN8

Expression Region

1-79

Origin

Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CNOT7 Antibody
NBP2-57301-25ul 25 µL

Rabbit Polyclonal CNOT7 Antibody

Sign In for Pricing
View Details
Sodium Iodoacetate
I7970-01 1 g

Sodium Iodoacetate

Sign In for Pricing
View Details
Sodium Iodoacetate
I7970-02 5 g

Sodium Iodoacetate

Sign In for Pricing
View Details
Sodium Iodoacetate
I7970-03 25 g

Sodium Iodoacetate

Sign In for Pricing
View Details
Sodium Iodoacetate
I7970-04 100 g

Sodium Iodoacetate

Sign In for Pricing
View Details
PCDH7 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
36113065 1.0 µg DNA

PCDH7 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details