Recombinant Shigella boydii serotype 18 ATP synthase subunit c (atpE)
This Recombinant Shigella boydii serotype 18 ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
B2TUN8
Expression Region
1-79
Origin
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K0201307 1.0 µg DNA
BTN1A1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
Sign In for Pricing
View Details 
128824-ML550 100 µL
KIF6 (C6orf102, dJ1043E3.1, dJ137F1.4, dJ188D3.1, DKFZp451I2418, Kinesin-like Protein KIF6, MGC33317) (MaxLight 550)
Sign In for Pricing
View Details 
31306151 3x 1.0 µg DNA
MYOCD CRISPR All-in-one AAV vector set (with saCas9)(Human)
Sign In for Pricing
View Details