Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Proteus mirabilis ATP synthase subunit c (atpE)

This Recombinant Proteus mirabilis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B4F0E2

Expression Region

1-79

Origin

Proteus mirabilis (strain HI4320)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLSMDLLYMAAAIMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A2 mL1 (NM_144670) Human Over-expression Lysate
E45H14071-2 20 µg

A2 mL1 (NM_144670) Human Over-expression Lysate

Sign In for Pricing
View Details
Dynamin 1 Recombinant Antibody, Cy7 Conjugated
bsm-61620R-Cy7-TR 20 µL

Dynamin 1 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Plk3 shRNA (UAS) - Lentiviral mouse Plk3 shRNA (UAS, iRFP) plasmid
GTR15189880 1 Vial

Lentiviral mouse Plk3 shRNA (UAS) - Lentiviral mouse Plk3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Recombinant Human Forkhead box protein C1 (FOXC1)
orb1881743-01 20 µg

Recombinant Human Forkhead box protein C1 (FOXC1)

Sign In for Pricing
View Details
Recombinant Human Forkhead box protein C1 (FOXC1)
orb1881743-02 100 µg

Recombinant Human Forkhead box protein C1 (FOXC1)

Sign In for Pricing
View Details
Recombinant Human Forkhead box protein C1 (FOXC1)
orb1881743-03 1 mg

Recombinant Human Forkhead box protein C1 (FOXC1)

Sign In for Pricing
View Details