Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Proteus mirabilis ATP synthase subunit c (atpE)

This Recombinant Proteus mirabilis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B4F0E2

Expression Region

1-79

Origin

Proteus mirabilis (strain HI4320)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLSMDLLYMAAAIMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C22orf25 Antibody - N-terminal region
ARP53122_P050-25UL 25 µL

C22orf25 Antibody - N-terminal region

Sign In for Pricing
View Details
Luciferase (AP)
MBS6241833-01 0.1 mL

Luciferase (AP)

Sign In for Pricing
View Details
Luciferase (AP)
MBS6241833-02 5x 0.1 mL

Luciferase (AP)

Sign In for Pricing
View Details
Tri-Sodium citratate I.P.
3125620 1 Each

Tri-Sodium citratate I.P.

Sign In for Pricing
View Details
Alexa Fluor® 647 anti-mouse CD279 (PD-1)
GT03957 25 µg

Alexa Fluor® 647 anti-mouse CD279 (PD-1)

Sign In for Pricing
View Details
RNU6-45 3'UTR GFP Stable Cell Line
TU070212 1.0 mL

RNU6-45 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details