Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella enteritidis PT4 ATP synthase subunit c (atpE)

This Recombinant Salmonella enteritidis PT4 ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B5QVD7

Expression Region

1-79

Origin

Salmonella enteritidis PT4 (strain P125109)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/294), Biotin conjugate, 0.1mg/mL
BNCB1836-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/294), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BAG3 Rabbit Monoclonal Antibody [Clone ID: R05-6D5]
TA383800 100 µL

BAG3 Rabbit Monoclonal Antibody [Clone ID: R05-6D5]

Sign In for Pricing
View Details
Norcamphor
TRC-N661390-5G 5 g

Norcamphor

Sign In for Pricing
View Details
YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), Biotin conjugate, 0.1mg/mL
BNCB2430-100 1x 100 µL

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (YBX1/2430), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DEFB105B (NM_001040703) Human Recombinant Protein
TP701109 50 µg

DEFB105B (NM_001040703) Human Recombinant Protein

Sign In for Pricing
View Details
LC3B Recombinant Chimeric Antibody Antibody
HA601532 100 µL

LC3B Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details