Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A ATP synthase subunit c (atpE)

This Recombinant Salmonella paratyphi A ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B5BIP1

Expression Region

1-79

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR24 Protein Vector (Human) (pPM-C-His)
PV046128 500 ng

WDR24 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Human DCBLD2/ESDN (C-6His)
CJ64-10ug 10 µg

Recombinant Human DCBLD2/ESDN (C-6His)

Sign In for Pricing
View Details
Anti-JAM-2/JAM-B Antibody, Rabbit Polyclonal
MBS8101581-01 0.1 mL

Anti-JAM-2/JAM-B Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-JAM-2/JAM-B Antibody, Rabbit Polyclonal
MBS8101581-02 5x 0.1 mL

Anti-JAM-2/JAM-B Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-DPPA2 Mouse Monoclonal Antibody [Clone ID: OTI1G10]
M12232 100 µL

Anti-DPPA2 Mouse Monoclonal Antibody [Clone ID: OTI1G10]

Sign In for Pricing
View Details
2,5-Di- (4-biphenylyl) -1,3,4-oxadiazole
FD66819-01 1 g

2,5-Di- (4-biphenylyl) -1,3,4-oxadiazole

Sign In for Pricing
View Details