Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A ATP synthase subunit c (atpE)

This Recombinant Salmonella paratyphi A ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B5BIP1

Expression Region

1-79

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SCF/KITLG/Kit ligand ELISA Kit PicoKine®
EK0507 96 Well With Removable Strips

Human SCF/KITLG/Kit ligand ELISA Kit PicoKine®

Sign In for Pricing
View Details
Bovine CD147 ELISA Kit
EBC0241 96 Tests

Bovine CD147 ELISA Kit

Sign In for Pricing
View Details
Mouse Anti-Human AKT Monoclonal Antibody (10D6)
MA83807HU-01 50 µg

Mouse Anti-Human AKT Monoclonal Antibody (10D6)

Sign In for Pricing
View Details
Mouse Anti-Human AKT Monoclonal Antibody (10D6)
MA83807HU-02 100 µg

Mouse Anti-Human AKT Monoclonal Antibody (10D6)

Sign In for Pricing
View Details
Mouse Anti-Human AKT Monoclonal Antibody (10D6)
MA83807HU-03 500 µg

Mouse Anti-Human AKT Monoclonal Antibody (10D6)

Sign In for Pricing
View Details
Mouse Anti-Human AKT Monoclonal Antibody (10D6)
MA83807HU-04 1 mg

Mouse Anti-Human AKT Monoclonal Antibody (10D6)

Sign In for Pricing
View Details