Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O81 ATP synthase subunit c (atpE)

This Recombinant Escherichia coli O81 ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B7N2H6

Expression Region

1-79

Origin

Escherichia coli O81 (strain ED1a)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL
BNC040633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-500 1x 500 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), CF647 conjugate, 0.1mg/mL
BNC470252-100 1x 100 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (K72.7), CF594 conjugate, 0.1mg/mL
BNC940757-500 1x 500 µL

Cytokeratin 7 (K72.7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (L1C1), CF740 conjugate, 0.1mg/mL
BNC740018-500 1x 500 µL

Human Kappa Light Chain (L1C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), 1mg/mL
BNUM0149-50 1x 50 µL

CD106 / VCAM1 (1.4C3), 1mg/mL

Sign In for Pricing
View Details