Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum ATP synthase subunit c (atpE)

This Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B8D6S2

Expression Region

1-79

Origin

Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNVDMLYIAVAIMVGLASIGAAIGIGILGGKFLEGAARQPDLVPLLRTQFFVVMGLV DAIPMIAVGLGLYMLFAIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF594 conjugate, 0.1mg/mL
BNC940039-500 1x 500 µL

CD34 (ICO-115), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-500 1x 500 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-100 1x 100 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL
BNC682216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-500 1x 500 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details