Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C ATP synthase subunit c (atpE)

This Recombinant Salmonella paratyphi C ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-79.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C0Q2N7

Expression Region

1-79

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLV DAIPMIAVGLGLYVMFAVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Papillomavirus 16 (HPV-16) (CAMVIR-1), Biotin conjugate, 0.1mg/mL
BNCB0502-500 1x 500 µL

Human Papillomavirus 16 (HPV-16) (CAMVIR-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF740 conjugate, 0.1mg/mL
BNC742000-100 1x 100 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin L1 Antibody
8C0295-AAT 50 µg

Cyclin L1 Antibody

Sign In for Pricing
View Details
Ccdc102a Mouse Gene Knockout Kit (CRISPR)
KN502627 1 Kit

Ccdc102a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human TFPI2 Protein (His Tag)
PKSH033117-01 10 µg

Recombinant Human TFPI2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human TFPI2 Protein (His Tag)
PKSH033117-02 50 µg

Recombinant Human TFPI2 Protein (His Tag)

Sign In for Pricing
View Details